![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.8: PglD-like [159280] (2 proteins) contains extra N-terminal alpha/beta subdomain this is a repeat family; one repeat unit is 2npo A:101-119 found in domain |
![]() | Protein Acetyltransferase PglD [159281] (1 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries) Uniprot Q0P9D1 3-197 |
![]() | Domain d2npoa1: 2npo A:3-195 [148338] Other proteins in same PDB: d2npoa2 |
PDB Entry: 2npo (more details), 2.2 Å
SCOPe Domain Sequences for d2npoa1:
Sequence, based on SEQRES records: (download)
>d2npoa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} rtekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirk kiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssv iehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqd ekgvfvgvpakrm
>d2npoa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} rtekiyiygghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirkki yqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvie hecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdek gvfvgvpakrm
Timeline for d2npoa1: