Lineage for d2np7a1 (2np7 A:21-243)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840062Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)
  6. 840063Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 840064Species Thermus aquaticus [TaxId:271] [53370] (12 PDB entries)
  8. 840070Domain d2np7a1: 2np7 A:21-243 [148336]
    Other proteins in same PDB: d2np7a2
    automatically matched to d1aqia1
    complexed with 3dr, 4pc, 6ma, gol, nea

Details for d2np7a1

PDB Entry: 2np7 (more details), 1.9 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing an abasic site analog at the target position and pyrrolo-dc at the target base partner position
PDB Compounds: (A:) modification methylase taqi

SCOP Domain Sequences for d2np7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np7a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

SCOP Domain Coordinates for d2np7a1:

Click to download the PDB-style file with coordinates for d2np7a1.
(The format of our PDB-style files is described here.)

Timeline for d2np7a1: