Lineage for d2nojf_ (2noj F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309244Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
    automatically mapped to Pfam PF12199
  5. 2309245Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
  6. 2309256Protein Uncharacterized protein SAV1155 [158370] (1 species)
  7. 2309257Species Staphylococcus aureus [TaxId:1280] [158371] (1 PDB entry)
    Uniprot Q99UV2 52-109
  8. 2309260Domain d2nojf_: 2noj F: [148329]
    Other proteins in same PDB: d2noja_, d2nojc_, d2noje_, d2nojg_
    automated match to d2nojb1

Details for d2nojf_

PDB Entry: 2noj (more details), 2.7 Å

PDB Description: Crystal structure of Ehp / C3d complex
PDB Compounds: (F:) Efb homologous protein

SCOPe Domain Sequences for d2nojf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nojf_ a.7.17.1 (F:) Uncharacterized protein SAV1155 {Staphylococcus aureus [TaxId: 1280]}
nkkvvdaqkavelfkrtrtvathrkaqravnlihfqhsyekkklqrqidlvlkyntlk

SCOPe Domain Coordinates for d2nojf_:

Click to download the PDB-style file with coordinates for d2nojf_.
(The format of our PDB-style files is described here.)

Timeline for d2nojf_: