Lineage for d2nojd_ (2noj D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696944Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
    automatically mapped to Pfam PF12199
  5. 2696945Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
    this is a repeat family; one repeat unit is 2gom A:105-165 found in domain
  6. 2696956Protein Uncharacterized protein SAV1155 [158370] (1 species)
  7. 2696957Species Staphylococcus aureus [TaxId:1280] [158371] (1 PDB entry)
    Uniprot Q99UV2 52-109
  8. 2696959Domain d2nojd_: 2noj D: [148327]
    Other proteins in same PDB: d2noja_, d2nojc_, d2noje_, d2nojg_
    automated match to d2nojb1

Details for d2nojd_

PDB Entry: 2noj (more details), 2.7 Å

PDB Description: crystal structure of ehp / c3d complex
PDB Compounds: (D:) Efb homologous protein

SCOPe Domain Sequences for d2nojd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nojd_ a.7.17.1 (D:) Uncharacterized protein SAV1155 {Staphylococcus aureus [TaxId: 1280]}
nkkvvdaqkavelfkrtrtvathrkaqravnlihfqhsyekkklqrqidlvlkyntlk

SCOPe Domain Coordinates for d2nojd_:

Click to download the PDB-style file with coordinates for d2nojd_.
(The format of our PDB-style files is described here.)

Timeline for d2nojd_: