![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.17: Efb C-domain-like [158366] (1 family) ![]() automatically mapped to Pfam PF12199 |
![]() | Family a.7.17.1: Efb C-domain-like [158367] (2 proteins) PfamB PB008033 this is a repeat family; one repeat unit is 2gom A:105-165 found in domain |
![]() | Protein Uncharacterized protein SAV1155 [158370] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [158371] (1 PDB entry) Uniprot Q99UV2 52-109 |
![]() | Domain d2nojb1: 2noj B:52-109 [148325] Other proteins in same PDB: d2noja_, d2nojc_, d2noje_, d2nojg_ |
PDB Entry: 2noj (more details), 2.7 Å
SCOPe Domain Sequences for d2nojb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nojb1 a.7.17.1 (B:52-109) Uncharacterized protein SAV1155 {Staphylococcus aureus [TaxId: 1280]} nkkvvdaqkavelfkrtrtvathrkaqravnlihfqhsyekkklqrqidlvlkyntlk
Timeline for d2nojb1: