Lineage for d2nnra_ (2nnr A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771405Superfamily b.1.26: ICP-like [141066] (2 families) (S)
    topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
  5. 1771406Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB PB014070
    automatically mapped to Pfam PF09394
  6. 1771407Protein Chagasin [141068] (1 species)
  7. 1771408Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
    Uniprot Q966X9 3-110
  8. 1771410Domain d2nnra_: 2nnr A: [148321]
    automated match to d2fo8a1
    complexed with cl, gol, so4

Details for d2nnra_

PDB Entry: 2nnr (more details), 1.7 Å

PDB Description: crystal structure of chagasin, cysteine protease inhibitor from trypanosoma cruzi
PDB Compounds: (A:) Chagasin

SCOPe Domain Sequences for d2nnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnra_ b.1.26.1 (A:) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

SCOPe Domain Coordinates for d2nnra_:

Click to download the PDB-style file with coordinates for d2nnra_.
(The format of our PDB-style files is described here.)

Timeline for d2nnra_: