Lineage for d2nnha1 (2nnh A:28-490)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774742Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 774743Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 774744Family a.104.1.1: Cytochrome P450 [48265] (22 proteins)
  6. 774987Protein Mammalian cytochrome p450 2c8 [101377] (1 species)
  7. 774988Species Human (Homo sapiens) [TaxId:9606] [101378] (5 PDB entries)
  8. 774991Domain d2nnha1: 2nnh A:28-490 [148317]
    automatically matched to d1pq2a_
    complexed with hem, plm, rea, so4

Details for d2nnha1

PDB Entry: 2nnh (more details), 2.6 Å

PDB Description: cyp2c8dh complexed with 2 molecules of 9-cis retinoic acid
PDB Compounds: (A:) Cytochrome P450 2C8

SCOP Domain Sequences for d2nnha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnha1 a.104.1.1 (A:28-490) Mammalian cytochrome p450 2c8 {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv

SCOP Domain Coordinates for d2nnha1:

Click to download the PDB-style file with coordinates for d2nnha1.
(The format of our PDB-style files is described here.)

Timeline for d2nnha1: