SCOP 1.75: Domain d2nnab1: 2nna B:93-190

Lineage for d2nnab1 (2nna B:93-190)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d2nnab1: 2nna B:93-190 [148315]
   Other proteins in same PDB: d2nnab2
   automatically matched to d1bx2b1

Details for d2nnab1

PDB Entry: 2nna, 2.1 Å

PDB Description: Structure of the MHC class II molecule HLA-DQ8 bound with a deamidated gluten peptide

PDB Compounds: (B:) MHC class II antigen

SCOP Domain Sequences for d2nnab1:

Sequence, based on SEQRES records:

>d2nnab1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewra

Sequence, based on observed residues (ATOM records):

>d2nnab1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrveptvtispllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqnpiivewra

Timeline for d2nnab1:

• d2nnab1 is new in SCOP 1.75
  
• d2nnab1 appears in SCOPe 2.01
  
• d2nnab1 appears in the current release, SCOPe 2.08