SCOPe 2.06: Domain d2nn6i2: 2nn6 I:6-60

Lineage for d2nn6i2 (2nn6 I:6-60)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins)
   ECR1 - Exosome complex RNA-binding protein 1

6. Protein Exosome component 1, EXOSC1 [159327] (1 species)
   3'-5' exoribonuclease CSL4 homolog

7. Species Human (Homo sapiens) [TaxId:9606] [159328] (1 PDB entry)
   Uniprot Q9Y3B2 6-60

8. Domain d2nn6i2: 2nn6 I:6-60 [148314]
   Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6f2, d2nn6g1, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h2, d2nn6h3, d2nn6i1
   protein/RNA complex

Details for d2nn6i2

PDB Entry: 2nn6, 3.35 Å

PDB Description: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40

PDB Compounds: (I:) 3'-5' exoribonuclease CSL4 homolog

SCOPe Domain Sequences for d2nn6i2:

Sequence; same for both SEQRES and ATOM records:

>d2nn6i2 b.84.4.2 (I:6-60) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]}
rycipgerlcnleegspgsgtytrhgyifsslagclmkssengalpvvsvvrete

Timeline for d2nn6i2:

• d2nn6i2 first appeared in SCOP 1.75
  
• d2nn6i2 appears in SCOPe 2.05
  
• d2nn6i2 appears in SCOPe 2.07
  
• d2nn6i2 appears in the current release, SCOPe 2.08