![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) ![]() rudiment single hybrid fold with a permuted topology |
![]() | Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins) ECR1 - Exosome complex RNA-binding protein 1 |
![]() | Protein Exosome component 1, EXOSC1 [159327] (1 species) 3'-5' exoribonuclease CSL4 homolog |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159328] (1 PDB entry) Uniprot Q9Y3B2 6-60 |
![]() | Domain d2nn6i2: 2nn6 I:6-60 [148314] Other proteins in same PDB: d2nn6a1, d2nn6a2, d2nn6b1, d2nn6b2, d2nn6c1, d2nn6c2, d2nn6d1, d2nn6d2, d2nn6e1, d2nn6e2, d2nn6f1, d2nn6f2, d2nn6g1, d2nn6g2, d2nn6g3, d2nn6h1, d2nn6h2, d2nn6h3, d2nn6i1 mutant |
PDB Entry: 2nn6 (more details), 3.35 Å
SCOP Domain Sequences for d2nn6i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nn6i2 b.84.4.2 (I:6-60) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} rycipgerlcnleegspgsgtytrhgyifsslagclmkssengalpvvsvvrete
Timeline for d2nn6i2: