Lineage for d2nn4c_ (2nn4 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754966Fold a.272: YqgQ-like [158378] (1 superfamily)
    3 helices, bundle, left-handed twist, extended overside connection between the first and second helices
  4. 1754967Superfamily a.272.1: YqgQ-like [158379] (1 family) (S)
    automatically mapped to Pfam PF06014
  5. 1754968Family a.272.1.1: YqgQ-like [158380] (1 protein)
    Pfam PF06014; DUF910
  6. 1754969Protein Hypothetical protein YqgQ [158381] (1 species)
  7. 1754970Species Bacillus subtilis [TaxId:1423] [158382] (1 PDB entry)
    Uniprot P54494 1-62
  8. 1754973Domain d2nn4c_: 2nn4 C: [148293]
    automated match to d2nn4a1

Details for d2nn4c_

PDB Entry: 2nn4 (more details), 2.1 Å

PDB Description: crystal structure of bacillus subtilis yqgq, pfam duf910
PDB Compounds: (C:) Hypothetical protein yqgQ

SCOPe Domain Sequences for d2nn4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nn4c_ a.272.1.1 (C:) Hypothetical protein YqgQ {Bacillus subtilis [TaxId: 1423]}
lntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkele
qt

SCOPe Domain Coordinates for d2nn4c_:

Click to download the PDB-style file with coordinates for d2nn4c_.
(The format of our PDB-style files is described here.)

Timeline for d2nn4c_: