SCOP 1.75: Domain d2nn4c1: 2nn4 C:1-62

Lineage for d2nn4c1 (2nn4 C:1-62)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.272: YqgQ-like [158378] (1 superfamily)
   3 helices, bundle, left-handed twist, extended overside connection between the first and second helices

4. Superfamily a.272.1: YqgQ-like [158379] (1 family)

5. Family a.272.1.1: YqgQ-like [158380] (1 protein)
   Pfam PF06014; DUF910

6. Protein Hypothetical protein YqgQ [158381] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158382] (1 PDB entry)
   Uniprot P54494 1-62

8. Domain d2nn4c1: 2nn4 C:1-62 [148293]
   automatically matched to 2NN4 A:1-62

Details for d2nn4c1

PDB Entry: 2nn4, 2.1 Å

PDB Description: crystal structure of bacillus subtilis yqgq, pfam duf910

PDB Compounds: (C:) Hypothetical protein yqgQ

SCOP Domain Sequences for d2nn4c1:

Sequence; same for both SEQRES and ATOM records:

>d2nn4c1 a.272.1.1 (C:1-62) Hypothetical protein YqgQ {Bacillus subtilis [TaxId: 1423]}
lntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkele
qt

Timeline for d2nn4c1:

• d2nn4c1 is new in SCOP 1.75
  
• d2nn4c1 is called d2nn4c_ in SCOPe 2.01
  
• d2nn4c1 appears in the current release, SCOPe 2.08, called d2nn4c2