Lineage for d2nn4b2 (2nn4 B:2-62)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351839Fold a.272: YqgQ-like [158378] (1 superfamily)
    3 helices, bundle, left-handed twist, extended overside connection between the first and second helices
  4. 2351840Superfamily a.272.1: YqgQ-like [158379] (1 family) (S)
    automatically mapped to Pfam PF06014
  5. 2351841Family a.272.1.1: YqgQ-like [158380] (1 protein)
    Pfam PF06014; DUF910
  6. 2351842Protein Hypothetical protein YqgQ [158381] (1 species)
  7. 2351843Species Bacillus subtilis [TaxId:1423] [158382] (1 PDB entry)
    Uniprot P54494 1-62
  8. 2351845Domain d2nn4b2: 2nn4 B:2-62 [148292]
    Other proteins in same PDB: d2nn4a2, d2nn4b3, d2nn4c3
    automated match to d2nn4a1

Details for d2nn4b2

PDB Entry: 2nn4 (more details), 2.1 Å

PDB Description: crystal structure of bacillus subtilis yqgq, pfam duf910
PDB Compounds: (B:) Hypothetical protein yqgQ

SCOPe Domain Sequences for d2nn4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nn4b2 a.272.1.1 (B:2-62) Hypothetical protein YqgQ {Bacillus subtilis [TaxId: 1423]}
ntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkeleq
t

SCOPe Domain Coordinates for d2nn4b2:

Click to download the PDB-style file with coordinates for d2nn4b2.
(The format of our PDB-style files is described here.)

Timeline for d2nn4b2: