![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.272: YqgQ-like [158378] (1 superfamily) 3 helices, bundle, left-handed twist, extended overside connection between the first and second helices |
![]() | Superfamily a.272.1: YqgQ-like [158379] (1 family) ![]() |
![]() | Family a.272.1.1: YqgQ-like [158380] (1 protein) Pfam PF06014; DUF910 |
![]() | Protein Hypothetical protein YqgQ [158381] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [158382] (1 PDB entry) Uniprot P54494 1-62 |
![]() | Domain d2nn4b1: 2nn4 B:1-62 [148292] automatically matched to 2NN4 A:1-62 |
PDB Entry: 2nn4 (more details), 2.1 Å
SCOP Domain Sequences for d2nn4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nn4b1 a.272.1.1 (B:1-62) Hypothetical protein YqgQ {Bacillus subtilis [TaxId: 1423]} lntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkele qt
Timeline for d2nn4b1: