Lineage for d2nm2d_ (2nm2 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207488Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. 2207489Protein 7,8-dihydroneopterin aldolase [55629] (4 species)
  7. 2207503Species Staphylococcus aureus [TaxId:1280] [55630] (13 PDB entries)
    Uniprot P56740
  8. 2207509Domain d2nm2d_: 2nm2 D: [148289]
    automated match to d1dhna_
    complexed with neu

Details for d2nm2d_

PDB Entry: 2nm2 (more details), 1.7 Å

PDB Description: crystal structure of dihydroneopterin aldolase from s. aureus in complex with (1s,2r)-neopterin at 1.50 angstrom resolution
PDB Compounds: (D:) dihydroneopterin aldolase

SCOPe Domain Sequences for d2nm2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nm2d_ d.96.1.3 (D:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus [TaxId: 1280]}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k

SCOPe Domain Coordinates for d2nm2d_:

Click to download the PDB-style file with coordinates for d2nm2d_.
(The format of our PDB-style files is described here.)

Timeline for d2nm2d_: