SCOPe 2.05: Domain d2nlub_: 2nlu B:

Lineage for d2nlub_ (2nlu B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein automated matches [190966] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188600] (7 PDB entries)

8. Domain d2nlub_: 2nlu B: [148285]
   automated match to d2b8aa1

Details for d2nlub_

PDB Entry: 2nlu

PDB Description: domain-swapped dimer of the pwwp module of human hepatoma-derived growth factor

PDB Compounds: (B:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d2nlub_:

Sequence; same for both SEQRES and ATOM records:

>d2nlub_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

Timeline for d2nlub_:

• d2nlub_ first appeared in SCOP 1.75, called d2nlub1
  
• d2nlub_ appears in SCOPe 2.04
  
• d2nlub_ appears in SCOPe 2.06
  
• d2nlub_ appears in the current release, SCOPe 2.08