SCOP 1.75: Domain d2nlub1: 2nlu B:101-200

Lineage for d2nlub1 (2nlu B:101-200)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families)

5. Family b.34.9.2: PWWP domain [69250] (5 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein Hepatoma-derived growth factor, HDGF [117151] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117152] (2 PDB entries)
   Uniprot P51858 1-100

8. Domain d2nlub1: 2nlu B:101-200 [148285]
   automatically matched to d2b8aa1

Details for d2nlub1

PDB Entry: 2nlu

PDB Description: domain-swapped dimer of the pwwp module of human hepatoma-derived growth factor

PDB Compounds: (B:) Hepatoma-derived growth factor

SCOP Domain Sequences for d2nlub1:

Sequence; same for both SEQRES and ATOM records:

>d2nlub1 b.34.9.2 (B:101-200) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy

Timeline for d2nlub1:

• d2nlub1 is new in SCOP 1.75
  
• d2nlub1 appears in SCOPe 2.01
  
• d2nlub1 appears in the current release, SCOPe 2.08, called d2nlub_