Lineage for d2k8ea2 (2k8e A:75-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617171Fold d.348: YegP-like [160112] (1 superfamily)
    comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands
  4. 2617172Superfamily d.348.1: YegP-like [160113] (2 families) (S)
  5. 2617173Family d.348.1.1: YegP-like [160114] (4 proteins)
    Pfam PF07411; DUF1508
  6. 2617192Protein Uncharacterized protein YegP [160119] (1 species)
    duplication: consists of two repeats
  7. 2617193Species Escherichia coli [TaxId:562] [160120] (1 PDB entry)
    Uniprot P76402 1-58! Uniprot P76402 59-110
  8. 2617195Domain d2k8ea2: 2k8e A:75-126 [148282]
    Other proteins in same PDB: d2k8ea3, d2k8ea4

Details for d2k8ea2

PDB Entry: 2k8e (more details)

PDB Description: solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102.
PDB Compounds: (A:) UPF0339 protein yegP

SCOPe Domain Sequences for d2k8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k8ea2 d.348.1.1 (A:75-126) Uncharacterized protein YegP {Escherichia coli [TaxId: 562]}
ktasngkfyfnlkaanhqiigssqmyataqsretgiasvkangtsqtvkdnt

SCOPe Domain Coordinates for d2k8ea2:

Click to download the PDB-style file with coordinates for d2k8ea2.
(The format of our PDB-style files is described here.)

Timeline for d2k8ea2: