SCOP 1.75: Domain d2k8ea1: 2k8e A:17-74

Lineage for d2k8ea1 (2k8e A:17-74)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.348: YegP-like [160112] (1 superfamily)
   comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands

4. Superfamily d.348.1: YegP-like [160113] (1 family)

5. Family d.348.1.1: YegP-like [160114] (4 proteins)
   Pfam PF07411; DUF1508

6. Protein Uncharacterized protein YegP [160119] (1 species)
   duplication: consists of two repeats

7. Species Escherichia coli [TaxId:562] [160120] (1 PDB entry)
   Uniprot P76402 1-58! Uniprot P76402 59-110

8. Domain d2k8ea1: 2k8e A:17-74 [148281]

Details for d2k8ea1

PDB Entry: 2k8e

PDB Description: solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102.

PDB Compounds: (A:) UPF0339 protein yegP

SCOP Domain Sequences for d2k8ea1:

Sequence; same for both SEQRES and ATOM records:

>d2k8ea1 d.348.1.1 (A:17-74) Uncharacterized protein YegP {Escherichia coli [TaxId: 562]}
magwfelskssdnqfrfvlkagngetiltselytsktsaekgiasvrsnspqeeryek

Timeline for d2k8ea1:

• d2k8ea1 is new in SCOP 1.75
  
• d2k8ea1 appears in SCOPe 2.01
  
• d2k8ea1 appears in the current release, SCOPe 2.08