Lineage for d2k7wa1 (2k7w A:1-192)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236526Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1236566Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1236567Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1236652Protein Proapoptotic molecule Bax [56862] (1 species)
  7. 1236653Species Human (Homo sapiens) [TaxId:9606] [56863] (2 PDB entries)
  8. 1236654Domain d2k7wa1: 2k7w A:1-192 [148280]
    automatically matched to d1f16a_

Details for d2k7wa1

PDB Entry: 2k7w (more details)

PDB Description: bax activation is initiated at a novel interaction site
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d2k7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7wa1 f.1.4.1 (A:1-192) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
ltasltiwkkmg

SCOPe Domain Coordinates for d2k7wa1:

Click to download the PDB-style file with coordinates for d2k7wa1.
(The format of our PDB-style files is described here.)

Timeline for d2k7wa1: