Lineage for d2k6qa1 (2k6q A:5-117)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018108Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
  6. 1018124Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (2 species)
  7. 1018127Species Norway rat (Rattus norvegicus) [TaxId:10116] [110803] (2 PDB entries)
    Uniprot Q62625 4-116
  8. 1018129Domain d2k6qa1: 2k6q A:5-117 [148277]
    automatically matched to d1ugma_

Details for d2k6qa1

PDB Entry: 2k6q (more details)

PDB Description: lc3 p62 complex structure
PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d2k6qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k6qa1 d.15.1.3 (A:5-117) Microtubule-associated proteins 1A/1B light chain 3B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

SCOPe Domain Coordinates for d2k6qa1:

Click to download the PDB-style file with coordinates for d2k6qa1.
(The format of our PDB-style files is described here.)

Timeline for d2k6qa1: