SCOP 1.75: Domain d2k6qa1: 2k6q A:5-117

Lineage for d2k6qa1 (2k6q A:5-117)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.3: GABARAP-like [54253] (3 proteins)
   intracellular membrane trafficking and fusion proteins

6. Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110803] (4 PDB entries)
   Uniprot Q62625 4-116

8. Domain d2k6qa1: 2k6q A:5-117 [148277]
   automatically matched to d1ugma_

Details for d2k6qa1

PDB Entry: 2k6q

PDB Description: lc3 p62 complex structure

PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3B

SCOP Domain Sequences for d2k6qa1:

Sequence; same for both SEQRES and ATOM records:

>d2k6qa1 d.15.1.3 (A:5-117) Microtubule-associated proteins 1A/1B light chain 3B {Rat (Rattus norvegicus) [TaxId: 10116]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

Timeline for d2k6qa1:

• d2k6qa1 is new in SCOP 1.75
  
• d2k6qa1 appears in SCOPe 2.01
  
• d2k6qa1 appears in the current release, SCOPe 2.08, called d2k6qa2