SCOPe 2.08: Domain d2k6qa2: 2k6q A:1-120

Lineage for d2k6qa2 (2k6q A:1-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110803] (2 PDB entries)
   Uniprot Q62625 4-116

8. Domain d2k6qa2: 2k6q A:1-120 [148277]
   Other proteins in same PDB: d2k6qa3
   automated match to d1v49a_

Details for d2k6qa2

PDB Entry: 2k6q

PDB Description: lc3 p62 complex structure

PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d2k6qa2:

Sequence; same for both SEQRES and ATOM records:

>d2k6qa2 d.15.1.3 (A:1-120) Microtubule-associated proteins 1A/1B light chain 3B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnm
selikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfg

Timeline for d2k6qa2:

• d2k6qa2 first appeared in SCOP 1.75, called d2k6qa1
  
• d2k6qa2 appears in SCOPe 2.07