Lineage for d2k5wa1 (2k5w A:2-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791208Superfamily b.40.13: BC4932-like [159121] (1 family) (S)
    automatically mapped to Pfam PF06486
  5. 2791209Family b.40.13.1: BC4932-like [159122] (2 proteins)
    Pfam PF06486; DUF1093
  6. 2791210Protein Uncharacterized protein BC2438 [159123] (1 species)
  7. 2791211Species Bacillus cereus [TaxId:1396] [159124] (1 PDB entry)
    Uniprot Q813L1 22-129
  8. 2791212Domain d2k5wa1: 2k5w A:2-109 [148275]
    Other proteins in same PDB: d2k5wa2, d2k5wa3

Details for d2k5wa1

PDB Entry: 2k5w (more details)

PDB Description: solution nmr structure of putative lipoprotein from bacillus cereus ordered locus bc_2438. northeast structural genomics target bcr103a.
PDB Compounds: (A:) Hypothetical Cytosolic Protein BcR103A

SCOPe Domain Sequences for d2k5wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k5wa1 b.40.13.1 (A:2-109) Uncharacterized protein BC2438 {Bacillus cereus [TaxId: 1396]}
eraslnrigkdvyymqikgegtiekvdgrnlrnytlpaydedgvkkqitfrstkkendhk
lnkyaflrlyvdqddnskneissievksyeeiqkadlpekvkdkftik

SCOPe Domain Coordinates for d2k5wa1:

Click to download the PDB-style file with coordinates for d2k5wa1.
(The format of our PDB-style files is described here.)

Timeline for d2k5wa1: