![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.13: BC4932-like [159121] (1 family) ![]() automatically mapped to Pfam PF06486 |
![]() | Family b.40.13.1: BC4932-like [159122] (2 proteins) Pfam PF06486; DUF1093 |
![]() | Protein Uncharacterized protein BC2438 [159123] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [159124] (1 PDB entry) Uniprot Q813L1 22-129 |
![]() | Domain d2k5wa1: 2k5w A:2-109 [148275] Other proteins in same PDB: d2k5wa2, d2k5wa3 |
PDB Entry: 2k5w (more details)
SCOPe Domain Sequences for d2k5wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k5wa1 b.40.13.1 (A:2-109) Uncharacterized protein BC2438 {Bacillus cereus [TaxId: 1396]} eraslnrigkdvyymqikgegtiekvdgrnlrnytlpaydedgvkkqitfrstkkendhk lnkyaflrlyvdqddnskneissievksyeeiqkadlpekvkdkftik
Timeline for d2k5wa1: