Lineage for d2k5qa1 (2k5q A:2-97)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791208Superfamily b.40.13: BC4932-like [159121] (1 family) (S)
    automatically mapped to Pfam PF06486
  5. 2791209Family b.40.13.1: BC4932-like [159122] (2 proteins)
    Pfam PF06486; DUF1093
  6. 2791213Protein Uncharacterized protein BC4932 [159125] (1 species)
  7. 2791214Species Bacillus cereus [TaxId:1396] [159126] (1 PDB entry)
    Uniprot Q812L6 22-117
  8. 2791215Domain d2k5qa1: 2k5q A:2-97 [148274]
    Other proteins in same PDB: d2k5qa2, d2k5qa3

Details for d2k5qa1

PDB Entry: 2k5q (more details)

PDB Description: nmr solution structure of membrane associated protein from bacillus cereus: northeast structural genomics consortium target: bcr97a
PDB Compounds: (A:) Hypothetical Membrane Associated Protein BcR97A

SCOPe Domain Sequences for d2k5qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k5qa1 b.40.13.1 (A:2-97) Uncharacterized protein BC4932 {Bacillus cereus [TaxId: 1396]}
dlnrmgkdeyyvqitvdgkevhskadngqkykdyeykltgfdkdgkekeleftaqknlrk
eaflrvyhsdkkgvsaweevkkdelpakvkeklgvk

SCOPe Domain Coordinates for d2k5qa1:

Click to download the PDB-style file with coordinates for d2k5qa1.
(The format of our PDB-style files is described here.)

Timeline for d2k5qa1: