Lineage for d2k54a1 (2k54 A:1-123)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2506181Family d.17.4.29: Atu0742-like [160047] (1 protein)
    PfamB PB017405
    automatically mapped to Pfam PF12680
  6. 2506182Protein Uncharacterized protein Atu0742 [160048] (1 species)
  7. 2506183Species Agrobacterium tumefaciens [TaxId:358] [160049] (1 PDB entry)
    Uniprot A9CJY7 1-123
  8. 2506184Domain d2k54a1: 2k54 A:1-123 [148271]

Details for d2k54a1

PDB Entry: 2k54 (more details)

PDB Description: Solution NMR structure of protein Atu0742 from Agrobacterium Tumefaciens. Northeast Structural Genomics Consortium (NESG0) target AtT8. Ontario Center for Structural Proteomics target ATC0727 .
PDB Compounds: (A:) Protein Atu0742

SCOPe Domain Sequences for d2k54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]}
mnseielpvqkqleaynardidafmawwaddcqyyafpatllagnaaeirvrhierfkep
dlygelltrvivgnvvidhetvtrnfpegkgevdvaciyevengriakawfkigeprivs
qks

SCOPe Domain Coordinates for d2k54a1:

Click to download the PDB-style file with coordinates for d2k54a1.
(The format of our PDB-style files is described here.)

Timeline for d2k54a1: