![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.8: Ribosomal protein S27a [161184] (1 protein) Pfam PF01599 |
![]() | Protein Ribosomal protein S27ae [161185] (1 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [161186] (1 PDB entry) Uniprot Q9HJ78 1-55 |
![]() | Domain d2k4xa1: 2k4x A:1-55 [148270] complexed with zn |
PDB Entry: 2k4x (more details)
SCOPe Domain Sequences for d2k4xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} mqkrelyeiadgklvrkhrfcprcgpgvflaehadryscgrcgytefkkakksks
Timeline for d2k4xa1: