SCOPe 2.08: Domain d2k49a2: 2k49 A:1-58

Lineage for d2k49a2 (2k49 A:1-58)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.348: YegP-like [160112] (1 superfamily)
   comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands

4. Superfamily d.348.1: YegP-like [160113] (2 families)

5. Family d.348.1.1: YegP-like [160114] (4 proteins)
   Pfam PF07411; DUF1508

6. Protein Uncharacterized protein SO3888 [160117] (1 species)
   duplication: consists of two repeats

7. Species Shewanella oneidensis [TaxId:70863] [160118] (1 PDB entry)
   Uniprot Q8EAL4 1-58! Uniprot Q8EAL4 59-110

8. Domain d2k49a2: 2k49 A:1-58 [148269]
   Other proteins in same PDB: d2k49a3

Details for d2k49a2

PDB Entry: 2k49

PDB Description: solution nmr structure of upf0339 protein so3888 from shewanella oneidensis. northeast structural genomics consortium target sor190

PDB Compounds: (A:) UPF0339 protein SO_3888

SCOPe Domain Sequences for d2k49a2:

Sequence; same for both SEQRES and ATOM records:

>d2k49a2 d.348.1.1 (A:1-58) Uncharacterized protein SO3888 {Shewanella oneidensis [TaxId: 70863]}
msgwyelskssndqfkfvlkagngeviltselytgksgamngiesvqtnspiearyak

Timeline for d2k49a2:

• d2k49a2 first appeared in SCOP 1.75
  
• d2k49a2 appears in SCOPe 2.07