![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.348: YegP-like [160112] (1 superfamily) comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands |
![]() | Superfamily d.348.1: YegP-like [160113] (2 families) ![]() |
![]() | Family d.348.1.1: YegP-like [160114] (4 proteins) Pfam PF07411; DUF1508 |
![]() | Protein Uncharacterized protein SO3888 [160117] (1 species) duplication: consists of two repeats |
![]() | Species Shewanella oneidensis [TaxId:70863] [160118] (1 PDB entry) Uniprot Q8EAL4 1-58! Uniprot Q8EAL4 59-110 |
![]() | Domain d2k49a2: 2k49 A:1-58 [148269] Other proteins in same PDB: d2k49a3 |
PDB Entry: 2k49 (more details)
SCOPe Domain Sequences for d2k49a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k49a2 d.348.1.1 (A:1-58) Uncharacterized protein SO3888 {Shewanella oneidensis [TaxId: 70863]} msgwyelskssndqfkfvlkagngeviltselytgksgamngiesvqtnspiearyak
Timeline for d2k49a2: