Lineage for d2k49a1 (2k49 A:59-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011381Fold d.348: YegP-like [160112] (1 superfamily)
    comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands
  4. 3011382Superfamily d.348.1: YegP-like [160113] (2 families) (S)
  5. 3011383Family d.348.1.1: YegP-like [160114] (4 proteins)
    Pfam PF07411; DUF1508
  6. 3011398Protein Uncharacterized protein SO3888 [160117] (1 species)
    duplication: consists of two repeats
  7. 3011399Species Shewanella oneidensis [TaxId:70863] [160118] (1 PDB entry)
    Uniprot Q8EAL4 1-58! Uniprot Q8EAL4 59-110
  8. 3011400Domain d2k49a1: 2k49 A:59-110 [148268]
    Other proteins in same PDB: d2k49a3

Details for d2k49a1

PDB Entry: 2k49 (more details)

PDB Description: solution nmr structure of upf0339 protein so3888 from shewanella oneidensis. northeast structural genomics consortium target sor190
PDB Compounds: (A:) UPF0339 protein SO_3888

SCOPe Domain Sequences for d2k49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k49a1 d.348.1.1 (A:59-110) Uncharacterized protein SO3888 {Shewanella oneidensis [TaxId: 70863]}
evakndkpyfnlkaanhqiigtsqmysstaardngiksvmengktttikdlt

SCOPe Domain Coordinates for d2k49a1:

Click to download the PDB-style file with coordinates for d2k49a1.
(The format of our PDB-style files is described here.)

Timeline for d2k49a1: