Lineage for d2k3fa1 (2k3f A:8-140)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896969Species Thermotoga maritima Huber et al. 1986 (Thermotoga maritima) [TaxId:2336] [161274] (2 PDB entries)
  8. 896970Domain d2k3fa1: 2k3f A:8-140 [148265]
    automatically matched to d1eg0k_

Details for d2k3fa1

PDB Entry: 2k3f (more details)

PDB Description: Ribosomal protein L11 from Thermotoga maritima
PDB Compounds: (A:) 50S ribosomal protein L11

SCOP Domain Sequences for d2k3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3fa1 i.1.1.1 (A:8-140) 70S ribosome functional complex {Thermotoga maritima Huber et al. 1986 (Thermotoga maritima) [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOP Domain Coordinates for d2k3fa1:

Click to download the PDB-style file with coordinates for d2k3fa1.
(The format of our PDB-style files is described here.)

Timeline for d2k3fa1: