Lineage for d2k2na1 (2k2n A:31-200)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870687Superfamily d.110.2: GAF domain-like [55781] (4 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 870688Family d.110.2.1: GAF domain [55782] (7 proteins)
  6. 870718Protein Sensor protein CYB2465 [160659] (1 species)
  7. 870719Species Synechococcus sp. [TaxId:1131] [160660] (1 PDB entry)
    Uniprot Q2JIZ5 31-200
  8. 870720Domain d2k2na1: 2k2n A:31-200 [148261]
    complexed with cyc

Details for d2k2na1

PDB Entry: 2k2n (more details)

PDB Description: solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state
PDB Compounds: (A:) Sensor protein

SCOP Domain Sequences for d2k2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k2na1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqael

SCOP Domain Coordinates for d2k2na1:

Click to download the PDB-style file with coordinates for d2k2na1.
(The format of our PDB-style files is described here.)

Timeline for d2k2na1: