SCOPe 2.08: Domain d2k2na1: 2k2n A:31-200

Lineage for d2k2na1 (2k2n A:31-200)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Sensor protein CYB2465 [160659] (2 species)

7. Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries)
   Uniprot Q2JIZ5 31-200

8. Domain d2k2na1: 2k2n A:31-200 [148261]
   Other proteins in same PDB: d2k2na2
   complexed with cyc

Details for d2k2na1

PDB Entry: 2k2n

PDB Description: solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state

PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d2k2na1:

Sequence; same for both SEQRES and ATOM records:

>d2k2na1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqael

Timeline for d2k2na1:

• d2k2na1 first appeared in SCOP 1.75
  
• d2k2na1 appears in SCOPe 2.07