Lineage for d2k2fa_ (2k2f A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319458Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2319459Protein Calcyclin (S100) [47479] (17 species)
  7. 2319662Species Norway rat (Rattus norvegicus), s100a1 [TaxId:10116] [69019] (4 PDB entries)
  8. 2319665Domain d2k2fa_: 2k2f A: [148258]
    automated match to d2k2fa1
    complexed with ca

Details for d2k2fa_

PDB Entry: 2k2f (more details)

PDB Description: Solution structure of Ca2+-S100A1-RyRP12
PDB Compounds: (A:) Protein S100-A1

SCOPe Domain Sequences for d2k2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k2fa_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100a1 [TaxId: 10116]}
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens

SCOPe Domain Coordinates for d2k2fa_:

Click to download the PDB-style file with coordinates for d2k2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2k2fa_: