| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
| Family a.5.2.1: UBA domain [46935] (25 proteins) |
| Protein Sequestosome 1 (Sqstm1) [101063] (1 species) ubiquitin-binding protein p62 |
| Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries) |
| Domain d2k0bx_: 2k0b X: [148253] automated match to d2k0bx1 |
PDB Entry: 2k0b (more details)
SCOPe Domain Sequences for d2k0bx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k0bx_ a.5.2.1 (X:) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh
Timeline for d2k0bx_: