SCOP 1.75: Domain d2jzsa1: 2jzs A:2-144

Lineage for d2jzsa1 (2jzs A:2-144)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain [142385] (1 species)

7. Species Neisseria meningitidis serogroup A [TaxId:65699] [142386] (3 PDB entries)
   Uniprot Q9JWM8 33-175

8. Domain d2jzsa1: 2jzs A:2-144 [148250]
   automatically matched to d2fy6a1

Details for d2jzsa1

PDB Entry: 2jzs

PDB Description: solution structure of the reduced form of the n-terminal domain of pilb from n. meningitidis.

PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA/msrB

SCOP Domain Sequences for d2jzsa1:

Sequence; same for both SEQRES and ATOM records:

>d2jzsa1 c.47.1.10 (A:2-144) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}
vphtlstlktadnrpasvylkkdkptlikfwaswcplclselgqtekwaqdakfssanli
tvaspgflhekkdgdfqkwyaglnypklpvvtdnggtiaqslnisvypswaligkdgdvq
rivkgsineaqalalirdpnadl

Timeline for d2jzsa1:

• d2jzsa1 is new in SCOP 1.75
  
• d2jzsa1 appears in SCOPe 2.01
  
• d2jzsa1 appears in the current release, SCOPe 2.08, called d2jzsa_