Lineage for d2jzoa_ (2jzo A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137127Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2137128Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2137129Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)
  6. 2137130Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)
  7. 2137131Species Escherichia coli [TaxId:562] [53065] (4 PDB entries)
  8. 2137137Domain d2jzoa_: 2jzo A: [148247]
    Other proteins in same PDB: d2jzod_
    automated match to d1pdoa_

Details for d2jzoa_

PDB Entry: 2jzo (more details)

PDB Description: solution nmr structure of the non-productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
PDB Compounds: (A:) PTS system mannose-specific EIIAB component

SCOPe Domain Sequences for d2jzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzoa_ c.54.1.1 (A:) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

SCOPe Domain Coordinates for d2jzoa_:

Click to download the PDB-style file with coordinates for d2jzoa_.
(The format of our PDB-style files is described here.)

Timeline for d2jzoa_: