Lineage for d2jzaa1 (2jza A:1-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795913Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 795914Superfamily b.33.1: ISP domain [50022] (3 families) (S)
  5. 796045Family b.33.1.3: NirD-like [158991] (1 protein)
    retains the common fold but lacks the Fe-S cluster
  6. 796046Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)
  7. 796047Species Erwinia carotovora [TaxId:554] [158994] (1 PDB entry)
    Uniprot Q6CZS1 1-122
  8. 796048Domain d2jzaa1: 2jza A:1-122 [148246]

Details for d2jzaa1

PDB Entry: 2jza (more details)

PDB Description: solution nmr structure of nitrite reductase [nad(p)h] small subunit from erwinia carotovora. northeast structural genomics consortium target ewr120
PDB Compounds: (A:) Nitrite reductase [NAD(P)H] small subunit

SCOP Domain Sequences for d2jzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]}
msqwttvcklddilpgtgvcalveqqqiavfrprndeqvyaisnidpfaqasvlsrgiva
ehqddlwvasplkkqhfrlydgfcledgaysvaaydtqvtngnvqisiadsdvavdnsqp
lp

SCOP Domain Coordinates for d2jzaa1:

Click to download the PDB-style file with coordinates for d2jzaa1.
(The format of our PDB-style files is described here.)

Timeline for d2jzaa1: