SCOPe 2.08: Domain d2jzaa1: 2jza A:1-122

Lineage for d2jzaa1 (2jza A:1-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.3: NirD-like [158991] (1 protein)
   retains the common fold but lacks the Fe-S cluster
   automatically mapped to Pfam PF13806

6. Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)

7. Species Erwinia carotovora [TaxId:554] [158994] (1 PDB entry)
   Uniprot Q6CZS1 1-122

8. Domain d2jzaa1: 2jza A:1-122 [148246]
   Other proteins in same PDB: d2jzaa2

Details for d2jzaa1

PDB Entry: 2jza

PDB Description: solution nmr structure of nitrite reductase [nad(p)h] small subunit from erwinia carotovora. northeast structural genomics consortium target ewr120

PDB Compounds: (A:) Nitrite reductase [NAD(P)H] small subunit

SCOPe Domain Sequences for d2jzaa1:

Sequence; same for both SEQRES and ATOM records:

>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]}
msqwttvcklddilpgtgvcalveqqqiavfrprndeqvyaisnidpfaqasvlsrgiva
ehqddlwvasplkkqhfrlydgfcledgaysvaaydtqvtngnvqisiadsdvavdnsqp
lp

Timeline for d2jzaa1:

• d2jzaa1 first appeared in SCOP 1.75
  
• d2jzaa1 appears in SCOPe 2.07