Lineage for d2jz3c1 (2jz3 C:17-112)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859355Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 859356Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 859357Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 859396Protein Elongin C [54699] (2 species)
  7. 859399Species Human (Homo sapiens) [TaxId:9606] [54700] (8 PDB entries)
  8. 859411Domain d2jz3c1: 2jz3 C:17-112 [148244]
    Other proteins in same PDB: d2jz3b1
    automatically matched to d1lm8c_

Details for d2jz3c1

PDB Entry: 2jz3 (more details)

PDB Description: SOCS box elonginBC ternary complex
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOP Domain Sequences for d2jz3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jz3c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

SCOP Domain Coordinates for d2jz3c1:

Click to download the PDB-style file with coordinates for d2jz3c1.
(The format of our PDB-style files is described here.)

Timeline for d2jz3c1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jz3b1