Lineage for d2jz3b1 (2jz3 B:1-106)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402170Protein Elongin B [54246] (2 species)
  7. 1402171Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries)
  8. 1402221Domain d2jz3b1: 2jz3 B:1-106 [148243]
    Other proteins in same PDB: d2jz3c1
    automatically matched to d1lm8b_

Details for d2jz3b1

PDB Entry: 2jz3 (more details)

PDB Description: SOCS box elonginBC ternary complex
PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d2jz3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jz3b1 d.15.1.1 (B:1-106) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq

SCOPe Domain Coordinates for d2jz3b1:

Click to download the PDB-style file with coordinates for d2jz3b1.
(The format of our PDB-style files is described here.)

Timeline for d2jz3b1: