Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (16 PDB entries) |
Domain d2jz3b1: 2jz3 B:1-106 [148243] Other proteins in same PDB: d2jz3c1 automatically matched to d1lm8b_ |
PDB Entry: 2jz3 (more details)
SCOPe Domain Sequences for d2jz3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jz3b1 d.15.1.1 (B:1-106) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq
Timeline for d2jz3b1: