SCOPe 2.06: Domain d2jyqa_: 2jyq A:

Lineage for d2jyqa_ (2jyq A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)

8. Domain d2jyqa_: 2jyq A: [148242]
   automated match to d1aotf_

Details for d2jyqa_

PDB Entry: 2jyq

PDB Description: nmr structure of the apo v-src sh2 domain

PDB Compounds: (A:) Tyrosine-protein kinase transforming protein Src

SCOPe Domain Sequences for d2jyqa_:

Sequence; same for both SEQRES and ATOM records:

>d2jyqa_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptsk

Timeline for d2jyqa_:

• d2jyqa_ first appeared in SCOP 1.75, called d2jyqa1
  
• d2jyqa_ appears in SCOPe 2.05
  
• d2jyqa_ appears in SCOPe 2.07
  
• d2jyqa_ appears in the current release, SCOPe 2.08