Lineage for d2jyoa1 (2jyo A:5-65)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929052Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2929090Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (3 PDB entries)
  8. 2929095Domain d2jyoa1: 2jyo A:5-65 [148241]
    automatically matched to d1m8aa_

Details for d2jyoa1

PDB Entry: 2jyo (more details)

PDB Description: nmr solution structure of human mip-3alpha/ccl20
PDB Compounds: (A:) C-C motif chemokine 20 (Small-inducible cytokine A20) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Liver and activation-regulated chemokine) (CC chemokine LARC) (Beta chemokine exodus-1)

SCOPe Domain Sequences for d2jyoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jyoa1 d.9.1.1 (A:5-65) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a [TaxId: 9606]}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
k

SCOPe Domain Coordinates for d2jyoa1:

Click to download the PDB-style file with coordinates for d2jyoa1.
(The format of our PDB-style files is described here.)

Timeline for d2jyoa1: