Lineage for d2jy8a2 (2jy8 A:3-52)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985405Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
    ubiquitin-binding protein p62
  7. 1985406Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries)
  8. 1985412Domain d2jy8a2: 2jy8 A:3-52 [148240]
    Other proteins in same PDB: d2jy8a3
    automated match to d2k0bx1

Details for d2jy8a2

PDB Entry: 2jy8 (more details)

PDB Description: nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1) in complex with ubiquitin. rdc refined
PDB Compounds: (A:) Ubiquitin-binding protein p62

SCOPe Domain Sequences for d2jy8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jy8a2 a.5.2.1 (A:3-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
ppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

SCOPe Domain Coordinates for d2jy8a2:

Click to download the PDB-style file with coordinates for d2jy8a2.
(The format of our PDB-style files is described here.)

Timeline for d2jy8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jy8a3