SCOPe 2.08: Domain d2jxta1: 2jxt A:1-78

Lineage for d2jxta1 (2jxt A:1-78)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.355: RplX-like [160373] (1 superfamily)
   beta(2)-alpha-beta-alpha; 3 layers, a/b/a; antiparallel beta-sheet, order: 213; some structural similarity to the PurS subunit/repeat (109622)

4. Superfamily d.355.1: RplX-like [160374] (1 family)
   similar structural motif to the Ribosomal S24e family (117786); possible structural permutation

5. Family d.355.1.1: RplX-like [160375] (1 protein)
   Pfam PF01911

6. Protein Ribosomal protein LX, RplX [160376] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [160377] (1 PDB entry)
   Uniprot O27647 1-78

8. Domain d2jxta1: 2jxt A:1-78 [148237]
   Other proteins in same PDB: d2jxta2

Details for d2jxta1

PDB Entry: 2jxt

PDB Description: solution structure of 50s ribosomal protein lx from methanobacterium thermoautotrophicum. northeast structural genomics consortium (nesg) target tr80

PDB Compounds: (A:) 50S ribosomal protein LX

SCOPe Domain Sequences for d2jxta1:

Sequence; same for both SEQRES and ATOM records:

>d2jxta1 d.355.1.1 (A:1-78) Ribosomal protein LX, RplX {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkmktkifrvkgkflmgdklqpftkelnaireeeiyerlysefgskhrvprskvkieeie
eispeevqdpvvkalvqr

Timeline for d2jxta1:

• d2jxta1 first appeared in SCOP 1.75
  
• d2jxta1 appears in SCOPe 2.07