Lineage for d2jxmb1 (2jxm B:1-246)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1972459Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 1972460Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 1972461Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 1972462Protein Cytochrome f-plastocyanin complex [58149] (2 species)
  7. 1972463Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [161284] (1 PDB entry)
  8. 1972464Domain d2jxmb1: 2jxm B:1-246 [148236]
    Other proteins in same PDB: d2jxma_
    automatically matched to d2pcfb_
    complexed with cu, hec

Details for d2jxmb1

PDB Entry: 2jxm (more details)

PDB Description: ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex
PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d2jxmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jxmb1 i.4.1.1 (B:1-246) Cytochrome f-plastocyanin complex {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
ypfyaqynydspreatgkivcanchlakktveievpqavlpdtvfkavvkvpydldiqqv
qadgspsglnvgavlmlpegfklappervdeelmeevgdfyylvtpysetdenillagpl
pgedyqemifpilspnpatdagvyfgkysihlggnrgrgqvyptgelsnnnafsasiagt
iaaiedngfgfdvtiqpedgdavvtsilpgpelivavgdtveagqllttnpnvggfgqmd
seivlq

SCOPe Domain Coordinates for d2jxmb1:

Click to download the PDB-style file with coordinates for d2jxmb1.
(The format of our PDB-style files is described here.)

Timeline for d2jxmb1: