Lineage for d2jxma_ (2jxm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774510Protein Plastocyanin [49507] (16 species)
  7. 1774554Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries)
  8. 1774555Domain d2jxma_: 2jxm A: [148235]
    Other proteins in same PDB: d2jxmb1
    automated match to d2jxma1
    complexed with cu, hec

Details for d2jxma_

PDB Entry: 2jxm (more details)

PDB Description: ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2jxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jxma_ b.6.1.1 (A:) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

SCOPe Domain Coordinates for d2jxma_:

Click to download the PDB-style file with coordinates for d2jxma_.
(The format of our PDB-style files is described here.)

Timeline for d2jxma_: