Lineage for d2jxma1 (2jxm A:1-97)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114706Protein Plastocyanin [49507] (16 species)
  7. 1114750Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries)
  8. 1114751Domain d2jxma1: 2jxm A:1-97 [148235]
    Other proteins in same PDB: d2jxmb1
    automatically matched to d1b3ia_
    complexed with cu, hec

Details for d2jxma1

PDB Entry: 2jxm (more details)

PDB Description: ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2jxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

SCOPe Domain Coordinates for d2jxma1:

Click to download the PDB-style file with coordinates for d2jxma1.
(The format of our PDB-style files is described here.)

Timeline for d2jxma1: