SCOPe 2.02: Domain d2jxma1: 2jxm A:1-97

Lineage for d2jxma1 (2jxm A:1-97)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries)

8. Domain d2jxma1: 2jxm A:1-97 [148235]
   Other proteins in same PDB: d2jxmb1
   automatically matched to d1b3ia_
   complexed with cu, hec

Details for d2jxma1

PDB Entry: 2jxm

PDB Description: ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2jxma1:

Sequence; same for both SEQRES and ATOM records:

>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

Timeline for d2jxma1:

• d2jxma1 first appeared in SCOP 1.75
  
• d2jxma1 appears in SCOPe 2.01
  
• d2jxma1 appears in SCOPe 2.03
  
• d2jxma1 appears in the current release, SCOPe 2.08, called d2jxma_