SCOPe 2.08: Domain d2jwwa_: 2jww A:

Lineage for d2jwwa_ (2jww A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (3 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [158476] (6 PDB entries)

8. Domain d2jwwa_: 2jww A: [148231]
   automated match to d1rwya_

Details for d2jwwa_

PDB Entry: 2jww

PDB Description: calcium-free rat alpha-parvalbumin

PDB Compounds: (A:) parvalbumin alpha

SCOPe Domain Sequences for d2jwwa_:

Sequence; same for both SEQRES and ATOM records:

>d2jwwa_ a.39.1.4 (A:) Parvalbumin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

Timeline for d2jwwa_:

• d2jwwa_ first appeared in SCOP 1.75, called d2jwwa1
  
• d2jwwa_ appears in SCOPe 2.07