| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein Engrailed Homeodomain [46691] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries) |
| Domain d2jwta2: 2jwt A:0-59 [148230] Other proteins in same PDB: d2jwta3 automated match to d1ztra1 |
PDB Entry: 2jwt (more details)
SCOPe Domain Sequences for d2jwta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jwta2 a.4.1.1 (A:0-59) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks
Timeline for d2jwta2: