Lineage for d2jwta2 (2jwt A:0-59)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691791Protein Engrailed Homeodomain [46691] (1 species)
  7. 2691792Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 2691814Domain d2jwta2: 2jwt A:0-59 [148230]
    Other proteins in same PDB: d2jwta3
    automated match to d1ztra1

Details for d2jwta2

PDB Entry: 2jwt (more details)

PDB Description: solution structure of engrailed homeodomain wt
PDB Compounds: (A:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d2jwta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jwta2 a.4.1.1 (A:0-59) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks

SCOPe Domain Coordinates for d2jwta2:

Click to download the PDB-style file with coordinates for d2jwta2.
(The format of our PDB-style files is described here.)

Timeline for d2jwta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jwta3