SCOPe 2.08: Domain d2jwta2: 2jwt A:0-59

Lineage for d2jwta2 (2jwt A:0-59)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Engrailed Homeodomain [46691] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)

8. Domain d2jwta2: 2jwt A:0-59 [148230]
   Other proteins in same PDB: d2jwta3
   automated match to d1ztra1

Details for d2jwta2

PDB Entry: 2jwt

PDB Description: solution structure of engrailed homeodomain wt

PDB Compounds: (A:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d2jwta2:

Sequence; same for both SEQRES and ATOM records:

>d2jwta2 a.4.1.1 (A:0-59) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks

Timeline for d2jwta2:

• d2jwta2 first appeared in SCOP 1.75, called d2jwta1
  
• d2jwta2 appears in SCOPe 2.07