| Class g: Small proteins [56992] (98 folds) |
| Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
| Family g.50.1.2: PHD domain [57911] (14 proteins) |
| Protein V(D)J recombination-activating protein 2, Rag2 [161224] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [161225] (2 PDB entries) Uniprot P21784 414-487 |
| Domain d2jwoa1: 2jwo A:414-487 [148229] Other proteins in same PDB: d2jwoa2 complexed with zn |
PDB Entry: 2jwo (more details)
SCOPe Domain Sequences for d2jwoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jwoa1 g.50.1.2 (A:414-487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqiara
Timeline for d2jwoa1: